PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 324aa    MW: 37047.5 Da    PI: 4.6821
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071110.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-092673012155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp+++++  LA+ +gL+++q+ +WF N+R ++
  XP_011071110.1 267 KWPYPTEADKISLAETTGLDQKQINNWFINQRKRH 301
                     679*****************************885 PP

2ELK31.15.4e-11221242122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++Llr Y+++++sLk EFs
  XP_011071110.1 221 ELKDRLLRRYGSHINSLKLEFS 242
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.5E-2291135IPR005540KNOX1
PfamPF037901.3E-2193133IPR005540KNOX1
SMARTSM012563.6E-25141192IPR005541KNOX2
PfamPF037914.2E-24145191IPR005541KNOX2
SMARTSM011881.1E-5221242IPR005539ELK domain
PfamPF037892.3E-8221242IPR005539ELK domain
PROSITE profilePS5121310.179221241IPR005539ELK domain
PROSITE profilePS5007112.892241304IPR001356Homeobox domain
SuperFamilySSF466891.45E-19242316IPR009057Homeodomain-like
SMARTSM003892.3E-13243308IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-28246305IPR009057Homeodomain-like
CDDcd000861.91E-13253305No hitNo description
PfamPF059208.4E-18261300IPR008422Homeobox KN domain
PROSITE patternPS000270279302IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDGMYGINPS TGSDDYADKA LLSPENLMIA AEYGQYHYDS MVPSGDYYHR NIPVFDSAEE  60
LGFQCSVVSE SASVNVQNPR EGDHDDEQAS SLIKAKIASH PSYPKLLDAY IDCQKVGAPP  120
EIARLLDEIR REKDLSKQDA VSMCLGVDPE LDEFMETYCD ILVKYKTDLS RPFDEATSFL  180
NKIETQLVNL CKDDGGLSSD EELSGGETEM QDSPMKTEDR ELKDRLLRRY GSHINSLKLE  240
FSKKKKKGKL PKEARQTLLE WWNVHYKWPY PTEADKISLA ETTGLDQKQI NNWFINQRKR  300
HWKPSENMHL AIMDNLSGHY LMED
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071110.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-132KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLV5K9531e-145V5K953_9R
STRINGVIT_01s0127g00210.t011e-142(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-106KNOTTED1-like homeobox gene 6